Protein Info for Xcc-8004.804.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: D-serine/D-alanine/glycine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 93 to 119 (27 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 155 to 178 (24 residues), see Phobius details amino acids 198 to 222 (25 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details amino acids 338 to 356 (19 residues), see Phobius details amino acids 362 to 387 (26 residues), see Phobius details amino acids 407 to 425 (19 residues), see Phobius details amino acids 431 to 450 (20 residues), see Phobius details PF00324: AA_permease" amino acids 18 to 454 (437 residues), 411.9 bits, see alignment E=3.5e-127 PF13520: AA_permease_2" amino acids 21 to 444 (424 residues), 155 bits, see alignment E=3.2e-49

Best Hits

Swiss-Prot: 69% identical to CYCA_ECOLI: D-serine/D-alanine/glycine transporter (cycA) from Escherichia coli (strain K12)

KEGG orthology group: K11737, D-serine/D-alanine/glycine transporter (inferred from 100% identity to xca:xccb100_0663)

MetaCyc: 69% identical to D-serine/alanine/glycine:H+symporter (Escherichia coli K-12 substr. MG1655)
RXN0-5130; RXN0-5201; RXN0-5202; RXN0-5203; TRANS-RXN-62A; TRANS-RXN-62B

Predicted SEED Role

"D-serine/D-alanine/glycine transporter" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X599 at UniProt or InterPro

Protein Sequence (459 amino acids)

>Xcc-8004.804.1 D-serine/D-alanine/glycine transporter (Xanthomonas campestris pv. campestris strain 8004)
MSDPSAPDHLQRSLSNRHLQLIAIGGAIGTGLFMGSGRTISLAGPSILFVYLIIGVMLFF
VMRAMGELLLSNLDYKSFIDFSTDLLGPWAGFFCGWTYWFCWIITAIADVIAIAAYAQFW
FPELAPWVPAVLCVLLLLALNLVTVKLFGEMEFWFALIKIIAICALIITGAGLVMWGFRS
PSGHVASLSNLWNDGGMFPMGIGGFFAGFQIAVFAFVGIELVGTTAAETADPQRNLPKAI
NSIPVRILIFYVLALIAIMAVTPWRQVVADKSPFVELFVLAGVPAAASLINFVVLTSATS
SANSGIFSTSRMLYGLAEERNAPRGFAKLTRAAVPARGLLFSCICLLLGAMLVYLIPDLV
TAFTLVTTLSAVLFMFVWSLILCAYIAYRRKRPEQHAASAFKMPGGVLMCYVCLAFFAFI
IVLLTLQPDTLHALLVSPLWFLVLAIAYWVRRNQSPTAR