Protein Info for Xcc-8004.706.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Propionyl-CoA:succinyl-CoA transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02550: AcetylCoA_hydro
  • amino acids 67 to 276 (210 residues), 105.3 bits, E=4.5e-34
• TIGR03458: succinate CoA transferase
  • amino acids 67 to 557 (491 residues), 778.4 bits, E=1.3e-238
• PF13336: AcetylCoA_hyd_C
  • amino acids 378 to 524 (147 residues), 139.3 bits, E=1e-44

Best Hits

Swiss-Prot: 58% identical to SCACT_ACEAC: Succinyl-CoA:acetate CoA-transferase from Acetobacter aceti

KEGG orthology group: None (inferred from 100% identity to xcc:XCC3588)

MetaCyc: 58% identical to succinyl-CoA:acetate CoA-transferase monomer (Acetobacter aceti)
RXN-8807 [EC: 2.8.3.18]

Predicted SEED Role

"Propionyl-CoA:succinyl-CoA transferase"

MetaCyc Pathways

• pyruvate fermentation to acetate V (3/3 steps found)
• TCA cycle VII (acetate-producers) (7/9 steps found)
• acetate formation from acetyl-CoA (succinate) (1/1 steps found)
• pyruvate fermentation to acetate VI (2/3 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (5/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)
• succinate fermentation to butanoate (1/7 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.3.18

Sequence Analysis Tools

See A0A0H2X3B0 at UniProt or InterPro

Protein Sequence (559 amino acids)

>Xcc-8004.706.1 Propionyl-CoA:succinyl-CoA transferase (Xanthomonas campestris pv. campestris strain 8004)
MRSVMSLPPLSRLGRRQGVNAFPPPDRIHHCTIVEAPPRQRSGDNLASPVTRYAPMSDER
ILNAPLRDHLVSAEAAAALIQPGETVAMSGFTGSGYPKAVPMALAQRIEAAHLQGEAFQI
KLMTGASTAPELDGALAKADGIAMRMPFQSDPDARQRINAGTLDYIDIHLSHVAQHVWFG
FYGQIDTAVVEVSAIRADGSLVPSTSIGNNKTWLDLARKVIIEVNDWQPAGLDGMHDVYY
GTALPPHRKPIPLLHGDDRIGEPSLRCDPDKIVAVVRTHGPDRNSPFAAADDSSERIAEH
LIAFLRHEVSKGRLPANLLPLQSGVGNIPNAVLAGLARSGFRDLEAFTEVIQDGMLALLR
DGVLRYASCTGFALSPEGNEEFKRNIDFYRQRIVMRTQEISNHPELVRRLGCIGMNGMIE
ADLYGNVNSTHVMGSRIMNGIGGSGDFARNGFLSIFLSPSIAKAGSISSIVPMVSHVDHT
EHDVSVIVTEQGLADLRGLTPKQRARQLLEHCVHPRYRDALEDYVARANRDSYGKHTPHL
LTEALAWHQRWLETGDMLG