Protein Info for Xcc-8004.675.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Ribosomal protein L11 methyltransferase (EC 2.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06325: PrmA
  • amino acids 3 to 304 (302 residues), 334.7 bits, E=2.3e-103
• TIGR00406: ribosomal protein L11 methyltransferase
  • amino acids 3 to 298 (296 residues), 219.8 bits, E=2.7e-69
• PF13489: Methyltransf_23
  • amino acids 151 to 281 (131 residues), 33.5 bits, E=1.4e-11
• PF13847: Methyltransf_31
  • amino acids 171 to 242 (72 residues), 29.2 bits, E=2.9e-10
• PF05175: MTS
  • amino acids 172 to 226 (55 residues), 29.6 bits, E=2.1e-10
• PF13649: Methyltransf_25
  • amino acids 175 to 263 (89 residues), 32.8 bits, E=3.7e-11
• PF08241: Methyltransf_11
  • amino acids 176 to 224 (49 residues), 24 bits, 2e-08
• PF08242: Methyltransf_12
  • amino acids 176 to 264 (89 residues), 31.2 bits, E=1.2e-10

Best Hits

Swiss-Prot: 100% identical to PRMA_XANCP: Ribosomal protein L11 methyltransferase (prmA) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K02687, ribosomal protein L11 methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to xca:xccb100_0542)

Predicted SEED Role

"Ribosomal protein L11 methyltransferase (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended or Ribosome biogenesis bacterial (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See Q4UZB8 at UniProt or InterPro

Protein Sequence (306 amino acids)

>Xcc-8004.675.1 Ribosomal protein L11 methyltransferase (EC 2.1.1.-) (Xanthomonas campestris pv. campestris strain 8004)
MPFLELTLPCTRATQPRFENALEDVGALAVTMLDAHAGTINERAILEPGVGEVRLWEETE
LTALFDGDSDPLMLLAALEAFDPSLDTRHATFRSVEDSAWERAWIDQFKPMRFGARTFIV
PWNQDLPEEANTPDAAVVRLDPGLAFGSGTHQTTALCLRWLDALAGEGQLQGCSVLDFGC
GSGILALAALKLGAANAVGVDYDPQALLATAENAERNAMEAQMQVYLPQDEPVQTYPVVL
ANILATALDALAETLAARVAPGGRIALSGIMQGQEQDLVQRYTPWFEHLHCEYDAEWVRI
DGVRRH