Protein Info for Xcc-8004.656.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: FIG01209718: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 747 transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 53 to 68 (16 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 154 to 181 (28 residues), see Phobius details amino acids 412 to 428 (17 residues), see Phobius details amino acids 434 to 450 (17 residues), see Phobius details amino acids 457 to 475 (19 residues), see Phobius details amino acids 481 to 498 (18 residues), see Phobius details amino acids 504 to 522 (19 residues), see Phobius details amino acids 528 to 550 (23 residues), see Phobius details amino acids 626 to 643 (18 residues), see Phobius details TIGR01667: integral membrane protein, YccS/YhfK family" amino acids 22 to 726 (705 residues), 747.9 bits, see alignment E=1e-228 TIGR01666: TIGR01666 family membrane protein" amino acids 23 to 726 (704 residues), 676.7 bits, see alignment E=3.4e-207 PF12805: FUSC-like" amino acids 81 to 367 (287 residues), 338.1 bits, see alignment E=7.3e-105 PF04632: FUSC" amino acids 412 to 724 (313 residues), 52 bits, see alignment E=1e-17 PF13515: FUSC_2" amino acids 424 to 544 (121 residues), 90.9 bits, see alignment E=1.5e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to xcc:XCC0496)

Predicted SEED Role

"FIG01209718: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X3R5 at UniProt or InterPro

Protein Sequence (747 amino acids)

>Xcc-8004.656.1 FIG01209718: hypothetical protein (Xanthomonas campestris pv. campestris strain 8004)
MPGHACPSETVATTSFESRLSRLWAHEKASYGLRVFIALAVAMGLCWHWQQLTAVPALFL
GAIASAIAETDDNWLGRSKSVLLSLLCFAAAAAAVVVLFPYPLAFVTGMAVATFSLTLLG
ALGERYASIAQATVALSIYAMIGMDQHGSHDPRIAWHGAALLLAGATWYGVLSILWTILF
ANRPVRERLSRLFFELGRYLTLKADLFEPVRQSDLHARRLALAEQNAKVVGALNAAKTAI
MSRFGRSGRPGVQSGLYFRLYYMAQEFHERASSSHYPYEALTDAFFHSDVLYRCQRLLAL
QGKACAALGEAIRLRQPFDYGDHSRLATDDLRQSLDYLHARADPALTRLLGALELLVTNL
QTIERRLSEAAQFDSTSDNLDTRLRDSSPHTVREMAARLGQQLTPGSVLFRHGLRMAIAL
VVGYAVMQSIHADNGYWILLTTAFVCRPNYGATRLRLVQRIAGTLIGLIATWALMQLFPG
TEVQLLLALAAALIFFITRTDRYMLATAGITVMALFCFNLLGDGFVLIWPRLIDTVIGCA
IAAAASFLILPDWQGRRLNQVMATVLASCARYLAQVLEQYASGMRDDLPYRIARRDMHNA
DAALSVALSNMLREPGRYRRNLEAGFRFLALSNTLLGYLSALGAHRAALDGEHDAGIAQA
GDYLQRTLGEIANALSLRQVLPVHDETEELAMADALEQHAVQLPPKQRLVRDQLALTLRL
LPKLRAAAVAVTAAPVETTAPKALQGA