Protein Info for Xcc-8004.621.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Anthranilate phosphoribosyltransferase (EC 2.4.2.18)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02885: Glycos_trans_3N
  • amino acids 6 to 67 (62 residues), 62.8 bits, E=2e-21
• TIGR01245: anthranilate phosphoribosyltransferase
  • amino acids 9 to 336 (328 residues), 412.2 bits, E=8.7e-128
• PF00591: Glycos_transf_3
  • amino acids 77 to 327 (251 residues), 304.2 bits, E=8.7e-95

Best Hits

Swiss-Prot: 100% identical to TRPD_XANCP: Anthranilate phosphoribosyltransferase (trpD) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K00766, anthranilate phosphoribosyltransferase [EC: 2.4.2.18] (inferred from 100% identity to xcc:XCC0469)

Predicted SEED Role

"Anthranilate phosphoribosyltransferase (EC 2.4.2.18)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 2.4.2.18)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• L-tryptophan biosynthesis (6/6 steps found)
• superpathway of chorismate metabolism (41/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.18

Sequence Analysis Tools

See Q4UZF9 at UniProt or InterPro

Protein Sequence (345 amino acids)

>Xcc-8004.621.1 Anthranilate phosphoribosyltransferase (EC 2.4.2.18) (Xanthomonas campestris pv. campestris strain 8004)
MPITPQQALQRTIEHREIFHDEMVDLMRQIMRGEVSDAMVSAILTGLRVKKETIGEIAGA
ATVMREFSRRVEVTDRRHMVDIVGTGGDGSHTFNISTCAMFVAAAGGAKVAKHGNRSVSS
KSGSADALEALGAVIELQPEQVAASLAQTGIGFMYAPVHHPAMKVVAPVRREMGVRTIFN
ILGPLTNPAGSPNILMGVFHPDLVGIQARVLQELGAERALVVWGRDGMDELSLGAGTLVG
ELRDGQVHEYEVHPEDFGIAMSASRNLKVADAAESRAMLLQVLDNVPGPALDIVALNAGA
ALYVAGVADSIADGIVRARQVLADGSARACLDAYVAFTQQATAQG