Protein Info for Xcc-8004.5393.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: LSU m5C1962 methyltransferase RlmI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 PF17785: PUA_3" amino acids 12 to 66 (55 residues), 61.5 bits, see alignment 3.2e-20 PF10672: Methyltrans_SAM" amino acids 169 to 300 (132 residues), 69 bits, see alignment E=2.5e-22 PF02475: Met_10" amino acids 178 to 266 (89 residues), 23.3 bits, see alignment E=2.9e-08 PF06325: PrmA" amino acids 194 to 290 (97 residues), 40.6 bits, see alignment E=1.3e-13 PF03602: Cons_hypoth95" amino acids 208 to 313 (106 residues), 39.9 bits, see alignment E=2.3e-13 PF13489: Methyltransf_23" amino acids 209 to 290 (82 residues), 29.3 bits, see alignment E=3.9e-10 PF05175: MTS" amino acids 212 to 293 (82 residues), 25.7 bits, see alignment E=4.8e-09 PF01728: FtsJ" amino acids 215 to 346 (132 residues), 44.7 bits, see alignment E=9.1e-15 PF13847: Methyltransf_31" amino acids 215 to 346 (132 residues), 50.4 bits, see alignment E=1.3e-16 PF09445: Methyltransf_15" amino acids 217 to 293 (77 residues), 24.5 bits, see alignment E=1.1e-08 PF13649: Methyltransf_25" amino acids 219 to 309 (91 residues), 43.6 bits, see alignment E=2.4e-14 PF08241: Methyltransf_11" amino acids 220 to 291 (72 residues), 26.4 bits, see alignment E=5.4e-09

Best Hits

Swiss-Prot: 35% identical to RLMI_VIBC3: Ribosomal RNA large subunit methyltransferase I (rlmI) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K06969, ribosomal RNA large subunit methyltransferase I [EC: 2.1.1.-] (inferred from 100% identity to xcb:XC_4320)

Predicted SEED Role

"LSU m5C1962 methyltransferase RlmI" in subsystem Ribosome biogenesis bacterial

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XD01 at UniProt or InterPro

Protein Sequence (389 amino acids)

>Xcc-8004.5393.1 LSU m5C1962 methyltransferase RlmI (Xanthomonas campestris pv. campestris strain 8004)
MNTPVPVVRLKNAWRSSHPWIFQKLVEKPAAKPKPGTIVDVVGVDGEWIGRGFYNGHSRI
AVRILETDQSVPVDAGWFSRKIAAAVSLRRDWLQLDGVSDAWRVVHSEGDGLSGLVVDRY
GDLVVVEFFAAGMFRHREWIYEALREQFPGCRFHSFADEHVQKQESFDFHSNTTTEASVI
TEYGIKFRADPAGAHKTGFFADQRENRQWLSEQVKDKTVLDLCCNTGGFAVYAAARGATE
VLGVDIDEDVIAIAKGNAKLNNVRPKFVQADIFPWLRDAANRGEKYDVVILDPAKMTRDR
EQVIPALKKYLDMNKLALGVVKPGGLFATFSCTGLVAEQEFLDMLRRASYFSGRTIQILK
VAGAGPDHPFMAHVQESRYLKAVFCRVVD