Protein Info for Xcc-8004.5385.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: FIG01211599: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 582 PF01590: GAF" amino acids 32 to 160 (129 residues), 50.1 bits, see alignment E=1.5e-16 PF13185: GAF_2" amino acids 35 to 163 (129 residues), 29 bits, see alignment E=4e-10 TIGR00229: PAS domain S-box protein" amino acids 310 to 431 (122 residues), 53.3 bits, see alignment E=2.9e-18 PF00989: PAS" amino acids 315 to 420 (106 residues), 27.2 bits, see alignment E=1.2e-09 PF08448: PAS_4" amino acids 326 to 425 (100 residues), 41.3 bits, see alignment E=5.6e-14 PF13426: PAS_9" amino acids 327 to 394 (68 residues), 24.7 bits, see alignment E=8.5e-09 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 434 to 575 (142 residues), 79 bits, see alignment E=3.3e-26 PF00990: GGDEF" amino acids 436 to 574 (139 residues), 79.5 bits, see alignment E=8.9e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to xca:xccb100_4445)

Predicted SEED Role

"FIG01211599: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XCY1 at UniProt or InterPro

Protein Sequence (582 amino acids)

>Xcc-8004.5385.1 FIG01211599: hypothetical protein (Xanthomonas campestris pv. campestris strain 8004)
LKQRHVAAPLAANETDRLARLALLRVVDSEAEPFFDALAAAAQAIAGTPIALVSLVDEHR
QWWKANVGLPGVSQTPRELAFCAHAILDDAVMEVPNASDDPRFSGNELVTDAPGIRYYAG
APIVLSDGLRMGTVCVIDQRPRQLQPAQLEALRHLARVAAEGLEQRRLMLERAETNAQLQ
QRLRESEAFLERTGRVAGVGGWEVDVASGTLSWSDQTCRLHDLPPGYRPSLGEAIAFYPL
DARAVITEAVEACVRDGTPWDLELPLISSTGRHLWVQSTGAMDMTDGRMRLIGAVQDVTD
RHRAMDALATSERKFRKMFQYSLGLICTHDMDGRLISVNPAAARSLGRSVEDMEGRALVE
LVRPERHAALHGYLSRMVLDGQDSGVIELVAGDGSLRHWQYHNVLDVEADGTVVLAHAQD
VTNQYKQEKQLLEWSFTDPLTNCFNRRYLDELDKRDPSVRWGCIVVDLDKFKLVNDTHGH
QRGDEVLVQMAWFLNQPLRTQDRLVRLGGDEFLGLLHQPTPAQLSALARDYLDAADDAPI
RFTLGSALRQDGEALAAVVDRADKSLYALRRSRRGSSPTDQR