Protein Info for Xcc-8004.5292.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02283: lytic murein transglycosylase
  • amino acids 24 to 272 (249 residues), 312.4 bits, E=1.6e-97
• PF13406: SLT_2
  • amino acids 25 to 270 (246 residues), 292.8 bits, E=1.3e-91

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.2.1.-)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Glycosaminoglycan degradation
• Nucleotide sugars metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Protein Sequence (512 amino acids)

>Xcc-8004.5292.1 Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-) (Xanthomonas campestris pv. campestris strain 8004)
MTPLWRALPLLLGLAPFAAWADPAFDRCLAGLQTQAAAKGVDAASFQRFTAGLAADPSVL
PLLDAQPEFTTPIWDYLASLVDSQRVSDGQAMLVTHRELLTRLSEQTGVDPATIVAVWGV
ESDYGRITGKRPLLVSLATLSCAGRRQPFFRGEFLALLGLLQQGDLAPEGLTGSWAGAFG
QTQFMPSTYARIAIDGDGDGRRDLVASIPDALASTANYLVKAGWERARPWGMEVRLPAGF
DANKAGRTRRQPLQAWQAAGLLGTDGKPLAPTGLPAETRRRPVGVGRAHRPRVPGVPELR
RDLRLQRGRKLRSLDRPAGRSPARWRRPGRLLAHRRSRPGPARTPATAATAAGPRPPDRR
SRWHGRHRHPPRHPGRADPPGPAAGRWSRRPTHPHRLAHRPAGDRRRRSRHRVHAAGGLS
RIRPISHRPEGIPHVRRHRPAHRRLPRFSLAADRHPVFHRGHQPVRRPTAVVRAQGRAGR
DVAVAHRQAAAHAHPRRRAGVLAVFRPPGSDR