Protein Info for Xcc-8004.5239.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Hexuronate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 86 to 104 (19 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details amino acids 154 to 184 (31 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details amino acids 302 to 323 (22 residues), see Phobius details amino acids 340 to 364 (25 residues), see Phobius details amino acids 376 to 393 (18 residues), see Phobius details amino acids 398 to 419 (22 residues), see Phobius details amino acids 431 to 457 (27 residues), see Phobius details amino acids 463 to 485 (23 residues), see Phobius details PF07690: MFS_1" amino acids 92 to 448 (357 residues), 198.1 bits, see alignment E=2e-62 PF00083: Sugar_tr" amino acids 121 to 259 (139 residues), 24.4 bits, see alignment E=1.4e-09

Best Hits

KEGG orthology group: K08191, MFS transporter, ACS family, hexuronate transporter (inferred from 100% identity to xcc:XCC4119)

Predicted SEED Role

"Hexuronate transporter" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XCQ4 at UniProt or InterPro

Protein Sequence (505 amino acids)

>Xcc-8004.5239.1 Hexuronate transporter (Xanthomonas campestris pv. campestris strain 8004)
MRVVMVALSPVAQCHPRAGAVVDESNRRTYGHRATFTALPHCAQGQRVQGIGMLPLRAAA
AVHVVSELPVNAAATGPLARLGRMRWRVCALLLAATTINYVDRQVLGVLAPFLQTQIGWN
EIQYGYIVTAFQAAYALGLLCSGAVIDRFGTRAGYALAIGIWSLAAMGHALATTVVGFAI
ARFFLGLGESGNFPAAIKTVAEWFPRRERALATGIFNSGSNIGAIVAPLLVPVIATAWGW
QAAFLFTGVLSATWLVVWWCSYHPPEQQPGLTAAELAHIRSDAHEPVQRRLSWLQVMRHR
QAWAFVLGKFITDPIWWFFLFWLPKFLHAEYGLSLLQLGAPLIVIFVLADIGSIAGGWVA
GRFIARGWSVNRARKTAMLICALSVVPIVFAASADNLWVAVGLIGLATAAHQGWSANLFT
LPSDMFPRHAVATVVGIGGFAGAVGGMLIATFIGFLLQATGSYVPVFLMAGSAYLLALAI
VHHLVPRLEPAQLPADAPAPPATHP