Protein Info for Xcc-8004.5217.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Starvation sensing protein RspA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 PF02746: MR_MLE_N" amino acids 30 to 127 (98 residues), 108.4 bits, see alignment E=2.6e-35 PF13378: MR_MLE_C" amino acids 210 to 394 (185 residues), 143 bits, see alignment E=1.2e-45

Best Hits

Swiss-Prot: 96% identical to MAND_XANOB: D-mannonate dehydratase (XOC_4468) from Xanthomonas oryzae pv. oryzicola (strain BLS256)

KEGG orthology group: K08323, starvation sensing protein RspA (inferred from 100% identity to xca:xccb100_4309)

Predicted SEED Role

"Starvation sensing protein RspA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XCP4 at UniProt or InterPro

Protein Sequence (419 amino acids)

>Xcc-8004.5217.1 Starvation sensing protein RspA (Xanthomonas campestris pv. campestris strain 8004)
MSQTVDSPSPLQGSARDREIVEARVIVTCPGRNFVTLKIRTRSGITGLGDATLNGRELAV
AAYLQEHLVPNLIGRDAGRIEDIWQFFYRGAYWRRGPVTMSAIAAVDVALWDILGKMAGL
PLYQLLGGRSREGALVYGHANGRDIAETSDEVGRFREMGFIAIRAQCGVPGIKKTYGISS
GGKPYEPAESELPTETVWSTPRYLGVVPKLFEQLRADHGDEIELLHDAHHRLTPIEAARL
GRDLEPYRLFWLEDATPAENQRAFEVIRQHTVTPLAVGEVFNSLWDCKHLIEQQLIDYIR
TTIVHAGGITHVRRLADFAALHQVRTGFHGATDLSPVCMGAALHFDTWVPNFGIQEYMFH
SDEANAVFPHDYVFRDGRLHCGETPGHGVDIDETLAAKYPYVPKQLPIARLEDGAMWDW