Protein Info for Xcc-8004.5185.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Gluconokinase (EC 2.7.1.12)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 PF13238: AAA_18" amino acids 18 to 132 (115 residues), 37.4 bits, see alignment E=5.2e-13 TIGR01313: carbohydrate kinase, thermoresistant glucokinase family" amino acids 18 to 176 (159 residues), 151.9 bits, see alignment E=6.7e-49 PF13671: AAA_33" amino acids 18 to 151 (134 residues), 58.8 bits, see alignment E=1.1e-19 PF01202: SKI" amino acids 25 to 175 (151 residues), 42.5 bits, see alignment E=1.2e-14

Best Hits

Swiss-Prot: 43% identical to GCNK_GLUOX: Gluconokinase (GOX1709) from Gluconobacter oxydans (strain 621H)

KEGG orthology group: K00851, gluconokinase [EC: 2.7.1.12] (inferred from 100% identity to xca:xccb100_4280)

MetaCyc: 37% identical to D-gluconate kinase, thermosensitive (Escherichia coli K-12 substr. MG1655)
Gluconokinase. [EC: 2.7.1.12]

Predicted SEED Role

"Gluconokinase (EC 2.7.1.12)" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 2.7.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XCC3 at UniProt or InterPro

Protein Sequence (180 amino acids)

>Xcc-8004.5185.1 Gluconokinase (EC 2.7.1.12) (Xanthomonas campestris pv. campestris strain 8004)
VMETAAAATPASASPLAIVVMGVSGSGKTTIAQALATHYGFRFLDADDYHSVAARAQMAS
GQPLTDAMRLPWVELLSATLRDCVQSGESVVLAFSGLRGTHRQLLRRSGVPMRFVFLHAA
PHVIAARLSARAGHFMPPSLLDSQLQTLELPLDEADVVSVDVDATVPEVVQDAIAQLALE