Protein Info for Xcc-8004.5094.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: FIG022199: FAD-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 414 to 433 (20 residues), see Phobius details PF00890: FAD_binding_2" amino acids 26 to 62 (37 residues), 31.1 bits, see alignment 6e-11 PF07992: Pyr_redox_2" amino acids 26 to 59 (34 residues), 27.7 bits, see alignment 7.4e-10 PF12831: FAD_oxidored" amino acids 26 to 58 (33 residues), 29.2 bits, see alignment (E = 2.5e-10) PF01134: GIDA" amino acids 26 to 57 (32 residues), 24.1 bits, see alignment (E = 7.4e-09) PF04820: Trp_halogenase" amino acids 26 to 98 (73 residues), 38.5 bits, see alignment E=2.8e-13 amino acids 114 to 371 (258 residues), 50.6 bits, see alignment E=6e-17 PF01266: DAO" amino acids 26 to 59 (34 residues), 33.2 bits, see alignment 1.7e-11 PF01494: FAD_binding_3" amino acids 26 to 342 (317 residues), 77.9 bits, see alignment E=3.6e-25 PF13450: NAD_binding_8" amino acids 29 to 62 (34 residues), 27.8 bits, see alignment 1e-09

Best Hits

KEGG orthology group: None (inferred from 99% identity to xca:xccb100_4206)

Predicted SEED Role

"FIG022199: FAD-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XDY1 at UniProt or InterPro

Protein Sequence (455 amino acids)

>Xcc-8004.5094.1 FIG022199: FAD-binding protein (Xanthomonas campestris pv. campestris strain 8004)
MTSTVVCPTPSAMPAAGQAPGPECPDVLIIGGGPAGCAAAIVLAQQGWAVTLLEKEQHPR
FHIGESLLPMNIPILERLGVLEQVRDIGVLKRGADFPNDAGGYNTFRFSHALDAKADYAF
QVPRAQFDQVLFARAREVGVDAREQVKVESVAFDGEQPVLQARGVDGVQQFRPRYLLDAS
GRDTFMGNRLKLKRANAKHQSAAVFSHFRGVTRRPGEDAGNISIYRHAHGWMWLIPLPDD
VMSVGAVCYPDYMKTRKGDSEGFLLRTLALNPEVAARMADAERVAPVHATGNYAYECTRM
SGPRWLLLGDAYTFVDPMFSSGVFLAMHSAERGAAMVDAVLRAPHREASLQRALSRELAR
GLSEFKWFIYRFTSPTMRALFAQPQNVWQVEQAVVAMLAGDVFDSPKVRRRLRVFRAIYS
VTALSMLPRAWHAWRHRRRQARLGFDGDTLHRDAP