Protein Info for Xcc-8004.5082.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: 3-oxoacyl-[ACP] reductase (EC 1.1.1.100)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 10 to 198 (189 residues), 172.1 bits, E=2e-54
• PF01370: Epimerase
  • amino acids 10 to 207 (198 residues), 29.5 bits, E=9.8e-11
• PF08659: KR
  • amino acids 11 to 185 (175 residues), 91.9 bits, E=9.8e-30
• PF13561: adh_short_C2
  • amino acids 19 to 244 (226 residues), 169.8 bits, E=1.6e-53

Best Hits

Swiss-Prot: 42% identical to FABG_AGGAC: 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) from Aggregatibacter actinomycetemcomitans

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 100% identity to xcc:XCC4003)

MetaCyc: 32% identical to D-gluconate 5-dehydrogenase monomer (Gluconobacter oxydans 621H)
1.1.1.-

Predicted SEED Role

"3-oxoacyl-[ACP] reductase (EC 1.1.1.100)" (EC 1.1.1.100)

MetaCyc Pathways

• superpathway of fatty acid biosynthesis I (E. coli) (13/16 steps found)
• biotin biosynthesis I (12/15 steps found)
• (5Z)-dodecenoate biosynthesis I (5/6 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
• palmitate biosynthesis III (21/29 steps found)
• gondoate biosynthesis (anaerobic) (3/4 steps found)
• 8-amino-7-oxononanoate biosynthesis I (8/11 steps found)
• superpathway of fatty acids biosynthesis (E. coli) (38/53 steps found)
• oleate biosynthesis IV (anaerobic) (10/14 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (22/31 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• stearate biosynthesis II (bacteria and plants) (4/6 steps found)
• stearate biosynthesis IV (4/6 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (14/20 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (6/9 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (3/5 steps found)
• cis-vaccenate biosynthesis (3/5 steps found)
• fatty acid elongation -- saturated (3/5 steps found)
• superpathway of fatty acid biosynthesis II (plant) (30/43 steps found)
• tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
• petroselinate biosynthesis (2/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• anteiso-branched-chain fatty acid biosynthesis (18/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (18/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (18/34 steps found)
• streptorubin B biosynthesis (15/34 steps found)
• mycolate biosynthesis (21/205 steps found)
• superpathway of mycolate biosynthesis (22/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

See A0A0H2XDX0 at UniProt or InterPro

Protein Sequence (245 amino acids)

>Xcc-8004.5082.1 3-oxoacyl-[ACP] reductase (EC 1.1.1.100) (Xanthomonas campestris pv. campestris strain 8004)
MSTSVPQRRALVTGGSGDLGGAICRQLAAQGRHVLVHANRNLARAEEVVASIVAAGGSAE
AVAFDVADAQASADALAALLEAGPIHIVVNNAGIHDDAPMAGMNAQQWHRVIDVSLHGFF
NVTQPLLLPMARARWGRIVSVSSVAAVLGNRGQTNYAAAKAALHGASKSLAREMASRGIA
VNVVAPGVIESEMVGDSFAPEMIKQMVPAGRVGKPDEVAALVAFLCSDVAGYINGQVIGI
NGGMG