Protein Info for Xcc-8004.5076.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: FIG143263: Glycosyl transferase @ Dolichyl-phosphate mannose synthase related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF13641: Glyco_tranf_2_3" amino acids 10 to 136 (127 residues), 28.6 bits, see alignment E=1.2e-10 PF00535: Glycos_transf_2" amino acids 13 to 133 (121 residues), 77.9 bits, see alignment E=9.2e-26

Best Hits

KEGG orthology group: None (inferred from 99% identity to xcc:XCC4000)

Predicted SEED Role

"FIG143263: Glycosyl transferase @ Dolichyl-phosphate mannose synthase related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XCF1 at UniProt or InterPro

Protein Sequence (273 amino acids)

>Xcc-8004.5076.1 FIG143263: Glycosyl transferase @ Dolichyl-phosphate mannose synthase related protein (Xanthomonas campestris pv. campestris strain 8004)
MSRIPLSRDDTAILVPALNESLRIREVVNDALTYCSQVIVIDDGSDDGTADCIADLPVTL
IRHPQRMGKGAALRSGFAEAQRQGMRAVMTMDGDGQHKAADFPRLLAAANRHPGAVIVGA
RMRKRATQPTIRRIGNDFGDWGIAWACGFRLVDSQSGQRLYPASVFTLPNVPGEGFVFEA
QLLISAARQAGARVVAVPIETRYAGTSPGTFRKSHFRLVRDLWNITSHVVKQVWAYGHVW
REYRRVRAHPVLIDDPDGEFATVPAVTKSNPST