Protein Info for Xcc-8004.5048.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 transmembrane" amino acids 37 to 60 (24 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 118 to 145 (28 residues), see Phobius details amino acids 154 to 177 (24 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 240 to 262 (23 residues), see Phobius details PF01061: ABC2_membrane" amino acids 23 to 232 (210 residues), 122.9 bits, see alignment E=1.4e-39 PF12698: ABC2_membrane_3" amino acids 72 to 260 (189 residues), 33.5 bits, see alignment E=2.5e-12

Best Hits

Swiss-Prot: 57% identical to YADH_SHIFL: Inner membrane transport permease YadH (yadH) from Shigella flexneri

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 100% identity to xcb:XC_4068)

Predicted SEED Role

"permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XCC8 at UniProt or InterPro

Protein Sequence (270 amino acids)

>Xcc-8004.5048.1 permease (Xanthomonas campestris pv. campestris strain 8004)
MSSPEPSMSAVPATSRQRNWVALGTIVRREVQRILRIWGQTLVPPAITMTLYFLIFGGLI
GSRVGDMGGYTYMQFIVPGLVMMSVIQNSYGNISSSFFGAKFGRHVEELLVSPMPNWVIL
WGYVAGAVLRGVMVGALVLIIAMFFTPVRIPHPLVTLTTVLLGATIFSLAGFVNAVYAKK
FDDVAIVPTFILTPLTYLGGVFYSVKLLPGWAEAATHANPIFYMVNAFRYGLLGSSDVPI
WVAYALMLGFVAVLSALALWLLRRGVGLRS