Protein Info for Xcc-8004.5008.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Two-component system regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 PF00072: Response_reg" amino acids 3 to 113 (111 residues), 97.8 bits, see alignment E=4.4e-32 PF00486: Trans_reg_C" amino acids 146 to 220 (75 residues), 85.1 bits, see alignment E=2.8e-28

Best Hits

Swiss-Prot: 44% identical to PHOP_SALTI: Virulence transcriptional regulatory protein PhoP (phoP) from Salmonella typhi

KEGG orthology group: K07660, two-component system, OmpR family, response regulator PhoP (inferred from 100% identity to xop:PXO_02836)

Predicted SEED Role

"Two-component system regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XBW7 at UniProt or InterPro

Protein Sequence (227 amino acids)

>Xcc-8004.5008.1 Two-component system regulatory protein (Xanthomonas campestris pv. campestris strain 8004)
MRILLVEDEAPLRETLAARLKREGFAVDAAQDGEEGLYMGREVPFDVGIIDLGLPKMSGM
ELIKALRDEGKKFPVLILTARSSWQDKVEGLKQGADDYLVKPFHVEELLARVNALLRRAA
GWSKPTLECGPVALDLAAQTVSVNGANVDLTSYEYKVLEYLMMHAGELVSKADLTEHIYQ
QDFDRDSNVLEVFIGRLRKKLDPDGELKPIETVRGRGYRFAIPRTEG