Protein Info for Xcc-8004.5001.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Pantothenate kinase type III, CoaX-like (EC 2.7.1.33)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to COAX_XANCP: Type III pantothenate kinase (coaX) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K03525, type III pantothenate kinase [EC: 2.7.1.33] (inferred from 100% identity to xcb:XC_4025)

Predicted SEED Role

"Pantothenate kinase type III, CoaX-like (EC 2.7.1.33)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.33)

MetaCyc Pathways

superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
superpathway of coenzyme A biosynthesis III (mammals) (5/5 steps found)
phosphopantothenate biosynthesis I (4/4 steps found)
superpathway of coenzyme A biosynthesis II (plants) (7/10 steps found)
phosphopantothenate biosynthesis II (1/3 steps found)

KEGG Metabolic Maps

Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4UPF9 at UniProt or InterPro

Protein Sequence (242 amino acids)

>Xcc-8004.5001.1 Pantothenate kinase type III, CoaX-like (EC 2.7.1.33) (Xanthomonas campestris pv. campestris strain 8004)
MSEWLFDLGNSRFKYAPLDGTRAGDVQAWAHGAEAMDTAALSALPSGKVAHVASVAAAGL
TERVLASLRTRFEQVRVVRTAAACAGVRIAYADPSRFGVDRFLALLGARGDAPVLVAGVG
TALTIDVLGADGQHHGGRIAASPTTMREALHARAVQLPPTGGAYAELANDTDDALTSGCD
GAAVALIERSLQHAARTLGMPVCLLVHGGGAPPLLPLLPTAEFRAALVLDGLATWATHSA
AP