Protein Info for Xcc-8004.498.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Biotin synthesis protein BioC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 TIGR02072: malonyl-acyl carrier protein O-methyltransferase BioC" amino acids 13 to 264 (252 residues), 240.5 bits, see alignment E=1.2e-75 PF13489: Methyltransf_23" amino acids 28 to 189 (162 residues), 55.5 bits, see alignment E=2.1e-18 PF01209: Ubie_methyltran" amino acids 40 to 163 (124 residues), 36.5 bits, see alignment E=1.2e-12 PF05175: MTS" amino acids 41 to 119 (79 residues), 26 bits, see alignment E=2.2e-09 PF13847: Methyltransf_31" amino acids 47 to 151 (105 residues), 46.2 bits, see alignment E=1.5e-15 PF13649: Methyltransf_25" amino acids 50 to 143 (94 residues), 69.7 bits, see alignment E=1e-22 PF08241: Methyltransf_11" amino acids 51 to 147 (97 residues), 74.1 bits, see alignment E=4e-24 PF08242: Methyltransf_12" amino acids 51 to 145 (95 residues), 50.6 bits, see alignment E=9.2e-17

Best Hits

Swiss-Prot: 71% identical to BIOC_XYLF2: Malonyl-[acyl-carrier protein] O-methyltransferase (bioC) from Xylella fastidiosa (strain M23)

KEGG orthology group: K02169, biotin synthesis protein BioC (inferred from 100% identity to xcc:XCC0383)

Predicted SEED Role

"Biotin synthesis protein BioC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X3I4 at UniProt or InterPro

Protein Sequence (294 amino acids)

>Xcc-8004.498.1 Biotin synthesis protein BioC (Xanthomonas campestris pv. campestris strain 8004)
MNSTFDPRHVRRAFARAASSYAAAAALQREVETRLLESLDYLGDTAPKVVLDVGAGPGHA
SATIKKRWPKAQVIALDQALPMLRQARKTAGWWKPFAQVCADARALPVADGSVDVIFSNL
CLQWVEDLPAVFAGFRRALRPGGLLLCSTFGPETLIELREAFAQADPAPHVSRFPPIAQF
GDALMMSGFRDPVLDRDLFTLTYNDLPALMRELRAMGATNALSNRRATLTGRGRFAAASA
AYEPLRRPDGTLPSSWEVIYAHAWAPAPGAPIRERGQDIASVPVGAIPIRRRQD