Protein Info for Xcc-8004.4952.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 transmembrane" amino acids 33 to 63 (31 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 170 to 188 (19 residues), see Phobius details amino acids 222 to 244 (23 residues), see Phobius details amino acids 256 to 282 (27 residues), see Phobius details amino acids 291 to 313 (23 residues), see Phobius details amino acids 324 to 350 (27 residues), see Phobius details PF01594: AI-2E_transport" amino acids 33 to 355 (323 residues), 152.6 bits, see alignment E=8.1e-49

Best Hits

KEGG orthology group: None (inferred from 100% identity to xca:xccb100_4091)

Predicted SEED Role

"transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XC58 at UniProt or InterPro

Protein Sequence (368 amino acids)

>Xcc-8004.4952.1 transport protein (Xanthomonas campestris pv. campestris strain 8004)
MNFPVDSLDAAEPADSLPPPPAPRPRAPASLVVLATLAVGYTLWAAQTIILPVMLAAFFA
LIGNPILRGLRKLYIPRFLGALMILCLGLAGTVALAAQLAGPAAEWVQQAPRQMRQIARD
VRDFTKPVQQANQAAENFARAAGGEGARGIQIVRTQLDDPYKSLTRTPKLAASVLAVVLL
TFFFMVYGESLQRHAIALLPNRQQQRFTTEIMLDIEREVSRYVLTISVINMLVGLVFAGI
LYVLKIPLPEALLWGTVVALLNFAPYVGPLIGVMLMLLMGFVEFRTTLSSLLPAILYLAL
HTIEGQVVTPIVLGRRMAISPLMLILALMLFGWLWGMVGLLLAVPLLVCIKMVLSRVEGM
QRWARLLE