Protein Info for Xcc-8004.4838.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details transmembrane" amino acids 83 to 103 (21 residues), see Phobius details amino acids 110 to 128 (19 residues), see Phobius details amino acids 134 to 151 (18 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 226 to 249 (24 residues), see Phobius details amino acids 301 to 322 (22 residues), see Phobius details amino acids 333 to 352 (20 residues), see Phobius details amino acids 363 to 382 (20 residues), see Phobius details PF02628: COX15-CtaA" amino acids 15 to 124 (110 residues), 70.9 bits, see alignment E=5e-24 amino acids 135 to 377 (243 residues), 148.3 bits, see alignment E=1.4e-47

Best Hits

KEGG orthology group: K02259, cytochrome c oxidase subunit XV assembly protein (inferred from 100% identity to xca:xccb100_4011)

Predicted SEED Role

"Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XBX9 at UniProt or InterPro

Protein Sequence (387 amino acids)

>Xcc-8004.4838.1 Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA (Xanthomonas campestris pv. campestris strain 8004)
MNLFAPPALFRHFHRMAWLAALFTASTILFGSFVRLSDAGMSCPDWPTCYGRVTWPQTSD
EANTHVASKIRPLESNKAWREQVHRFLAGALGVEVLVLTLLAARRRRAGIAQVVSAAALV
ALSIPLYMSGWHGLAMGVAAAGEAILLLAALRWSNIDLARAAVLTLAVVIFQALLGMWTV
TLLLKPIVVMGHLLGGMLMFSLLVWMAWRATHLPITLADASRLKWLLRLGVAVLGLQIAL
GGWVSANYAALACGGGSWSADNFPKCVSQWWPPHDFRAGFTLWRGIGVDYEGGVLDGAAR
IAIQMAHRLWAIATALYLWWLAWRLSRSPGMRVWAGALALLVVVQVTLGMLNVKLALPLE
VSVLHNGGAVALLFVLVSLLARLRAPE