Protein Info for Xcc-8004.4825.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Dihydroneopterin aldolase (EC 4.1.2.25)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00526: FolB domain
  • amino acids 1 to 116 (116 residues), 112.9 bits, E=1e-36
• TIGR00525: dihydroneopterin aldolase
  • amino acids 2 to 114 (113 residues), 87.9 bits, E=6.9e-29
• PF02152: FolB
  • amino acids 4 to 113 (110 residues), 114.7 bits, E=1.7e-37

Best Hits

Swiss-Prot: 50% identical to FOLB_ECOLI: Dihydroneopterin aldolase (folB) from Escherichia coli (strain K12)

KEGG orthology group: K01633, dihydroneopterin aldolase [EC: 4.1.2.25] (inferred from 99% identity to xca:xccb100_4000)

MetaCyc: 50% identical to dihydroneopterin aldolase (Escherichia coli K-12 substr. MG1655)
RXN-10856 [EC: 5.1.99.8]; Dihydroneopterin aldolase. [EC: 5.1.99.8, 4.1.2.25]

Predicted SEED Role

"Dihydroneopterin aldolase (EC 4.1.2.25)" in subsystem Folate Biosynthesis (EC 4.1.2.25)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (3/5 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis III (Chlamydia) (3/5 steps found)
• superpathway of chorismate metabolism (41/59 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis II (Methanocaldococcus) (2/7 steps found)
• tetrahydromethanopterin biosynthesis (3/14 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.25 or 5.1.99.8

Sequence Analysis Tools

See A0A0H2XDE7 at UniProt or InterPro

Protein Sequence (117 amino acids)

>Xcc-8004.4825.1 Dihydroneopterin aldolase (EC 4.1.2.25) (Xanthomonas campestris pv. campestris strain 8004)
MDKVFIEGLDIDALIGIYDWERRIRQTLRFDLEMGFDNRIPAASDDIADTLNYKAVSKRL
IEFVQQSEFGLVETLAERCAAIVLDEFQVQWLRLKLSKPGAVRGAQAVGVIIERSRS