Protein Info for Xcc-8004.4777.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: ATP-dependent RNA helicase RhlB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 589 PF00270: DEAD" amino acids 49 to 222 (174 residues), 150.7 bits, see alignment E=5e-48 PF00271: Helicase_C" amino acids 260 to 368 (109 residues), 103.3 bits, see alignment E=1.3e-33 PF12300: RhlB" amino acids 393 to 567 (175 residues), 308.5 bits, see alignment E=3.2e-96

Best Hits

Swiss-Prot: 100% identical to RHLB_XANC8: ATP-dependent RNA helicase RhlB (rhlB) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K03732, ATP-dependent RNA helicase RhlB [EC: 3.6.4.13] (inferred from 100% identity to xca:xccb100_3958)

Predicted SEED Role

"ATP-dependent RNA helicase RhlB" in subsystem ATP-dependent RNA helicases, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.13

Use Curated BLAST to search for 3.6.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4UPY5 at UniProt or InterPro

Protein Sequence (589 amino acids)

>Xcc-8004.4777.1 ATP-dependent RNA helicase RhlB (Xanthomonas campestris pv. campestris strain 8004)
MQAAPGLPRAPHEDGIMSDKPLTDLTFSSFDLHPALVAGLESAGFTRCTPIQALTLPVAL
PGGDVAGQAQTGTGKTLAFLVAVMNRLLIRPALADRKPEDPRALILAPTRELAIQIHKDA
VKFGADLGLRFALVYGGVDYDKQRELLQQGVDVIIATPGRLIDYVKQHKVVSLHACEICV
LDEADRMFDLGFIKDIRFLLRRMPERGTRQTLLFSATLSHRVLELAYEHMNEPEKLVVET
ETITAARVRQRIYFPSDEEKQTLLLGLLSRSEGARTMVFVNTKAFVERVARTLERHGYRV
GVLSGDVPQKKRESLLNRFQKGQLEILVATDVAARGLHIDGVKYVYNYDLPFDAEDYVHR
IGRTARLGEEGDAISFACERYAMSLPDIEAYIEQKIPVEPVTTELLTPLPRTPRATVEGE
EVDDDAGDSVGTIFREAREQRAADEARRGGGRSGPGGASRSGSGGGRRDGAGADGKPRPP
RRKPRVEGEADPAAAPSETPVVVAAAAETPAVTAAEGERAPRKRRRRRNGRPVEGAEPVV
ASTPVPAPAAPRKPTQVVAKPVRAAAKPSGSPSLLSRIGRRLRSLVSGS