Protein Info for Xcc-8004.4769.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: NADH dehydrogenase (EC 1.6.99.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 374 to 393 (20 residues), see Phobius details amino acids 395 to 395 (1 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 11 to 327 (317 residues), 170.7 bits, see alignment E=1.5e-53 PF13450: NAD_binding_8" amino acids 14 to 43 (30 residues), 22.1 bits, see alignment (E = 4.6e-08) PF00070: Pyr_redox" amino acids 165 to 245 (81 residues), 41.9 bits, see alignment E=3.6e-14

Best Hits

KEGG orthology group: K03885, NADH dehydrogenase [EC: 1.6.99.3] (inferred from 100% identity to xcb:XC_3841)

Predicted SEED Role

"NADH dehydrogenase (EC 1.6.99.3)" in subsystem Carboxysome or Respiratory dehydrogenases 1 (EC 1.6.99.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XDG6 at UniProt or InterPro

Protein Sequence (428 amino acids)

>Xcc-8004.4769.1 NADH dehydrogenase (EC 1.6.99.3) (Xanthomonas campestris pv. campestris strain 8004)
MTSSPSRAPLHLVVVGGGFAGLWATRALADPDIRITLIDRQNHHLFQPLLYQVATAGLSA
PDIAAPLRHILREQRNVEVLLGDVAEIATDRRAVVLADGNTVNYDMLLLATGATHAYFGN
DHWAEHAPGLKTLYDALVLRRKLLLAFERAEAESDPAARAAWLSFAVVGGGPTGVELAGT
LAEIARHTLKNEFRHIDPQQARVRLVEAGPRVLPSFPDDLTDKARKQLERLGVEVHTGTP
VTNIDAFGYQLGDTFVPARTVVWAAGVAASPLARTLGVPLDRAGRVLVEPDLSVPGHPEI
FVGGDLASVQQDGRPVPGVAPAAKQMGKHIAKAIRARQRGQAAPAFHYQDFGNLATIGRM
AAIVHVGKLKLSGIVAWWFWLAAHVYFLIGFRNRFVVLVNWAMAYWSYQRAARIIFGGTD
QPPPSKDG