Protein Info for Xcc-8004.4746.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR00732: DNA protecting protein DprA" amino acids 71 to 287 (217 residues), 234.6 bits, see alignment E=3.9e-74 PF02481: DNA_processg_A" amino acids 74 to 280 (207 residues), 241.7 bits, see alignment E=4.8e-76 PF17782: DprA_WH" amino acids 315 to 372 (58 residues), 60.9 bits, see alignment E=9.5e-21

Best Hits

KEGG orthology group: K04096, DNA processing protein (inferred from 100% identity to xca:xccb100_3932)

Predicted SEED Role

"Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XD91 at UniProt or InterPro

Protein Sequence (378 amino acids)

>Xcc-8004.4746.1 Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake (Xanthomonas campestris pv. campestris strain 8004)
MDLTEPDRRALLTLLLAGGRSPPRRALLDAFDAPSQILAAGPAAWRAAGCDALQIAKLQT
PDTPILDAALRWCAQPGHHLIGWRDADYPALLRHIANPPLMLFVDGDPAALWHPCVAVVG
SRAASAGGRDHTRHFAASLANAGLGIVSGMAAGVDAIAHEAALAHADGITVAVVGTGPDV
AYPVQHHSLRDRIAARSAVVSEYLPGTCAVAAHFPARNRIIAGLALGTLVVEAAMRSGAL
ITARLAAEAGREVFAVPGSLHNPLARGCHHLIRQGATLVQEPAQLVEGLRLLSGELADAL
RQRLTAPTEQARTVPQPTPRRSDPDYQRLWHALGHDPTPMDSLLERTGLTAAALSSMLLI
MELEGDVVTEHGRYTRNP