Protein Info for Xcc-8004.4741.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01029: NusB
  • amino acids 12 to 133 (122 residues), 79.6 bits, E=8.5e-26
• TIGR00563: 16S rRNA (cytosine(967)-C(5))-methyltransferase
  • amino acids 16 to 434 (419 residues), 334.3 bits, E=6.9e-104
• PF01189: Methyltr_RsmB-F
  • amino acids 241 to 432 (192 residues), 178.7 bits, E=3.5e-56
• PF01728: FtsJ
  • amino acids 242 to 392 (151 residues), 25.2 bits, E=4.4e-09
• PF13649: Methyltransf_25
  • amino acids 250 to 323 (74 residues), 29 bits, E=4.3e-10

Best Hits

Swiss-Prot: 100% identical to RSMB_XANCP: Ribosomal RNA small subunit methyltransferase B (rsmB) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K03500, ribosomal RNA small subunit methyltransferase B [EC: 2.1.1.-] (inferred from 100% identity to xcc:XCC3747)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See A0A0H2XBQ7 at UniProt or InterPro

Protein Sequence (436 amino acids)

>Xcc-8004.4741.1 hypothetical protein (Xanthomonas campestris pv. campestris strain 8004)
MAAETAAAGVASRLAAARILAAVFDQGRSLKAELTAALPGVSDPRDRALVEAICFAVLRR
RPAYDVALRQWLERPLPPRDAELKALLMAGFAQLDVLQLPAHAALSATVEACRALGRPRQ
AGMVNAVLRRAQREGFPAVADDAGWPSWLRKQLRADWGDQAEAIFVESARMAPMWLRVPR
ARVSPAEYVARLAEQGITAHTDPVLADAVRLDTAVPVSQLPGFAQGDVSVQDGSAQQVAD
ALALAPAARVLDACAAPGGKAAHLLERHPQLQLTALDVDARRLERVRQTVQRTAPDRTVR
LHAADAADTAAWWDGQPFDAVLLDAPCSATGVVRRQPDVLLHRRADDIDALCALQARLLE
ACWRTLRPGGQLLYTTCSLLKRENQTQIEAFLQRTADAQAQPLGAQFGHAAGAGRQRFPG
EQQCDGFFYALLLKAS