Protein Info for Xcc-8004.4739.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Lipid A core - O-antigen ligase and related enzymes

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 28 to 59 (32 residues), see Phobius details amino acids 71 to 93 (23 residues), see Phobius details amino acids 105 to 120 (16 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 182 to 198 (17 residues), see Phobius details amino acids 204 to 221 (18 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details amino acids 336 to 356 (21 residues), see Phobius details amino acids 369 to 390 (22 residues), see Phobius details amino acids 396 to 412 (17 residues), see Phobius details PF04932: Wzy_C" amino acids 188 to 344 (157 residues), 78.5 bits, see alignment E=2.4e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to xcb:XC_3815)

Predicted SEED Role

"Lipid A core - O-antigen ligase and related enzymes"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XD87 at UniProt or InterPro

Protein Sequence (429 amino acids)

>Xcc-8004.4739.1 Lipid A core - O-antigen ligase and related enzymes (Xanthomonas campestris pv. campestris strain 8004)
MNSLPSPHPPLSPAVPVASRAALRLAELGVFVLTALVVNMPSGLLPFGVCLLGGTLLGWR
SLRAGLATQGWSLRVLTGLTAVVIAMSVLSIVLFEPSVRDVENRSRFLVLPWAALWAYAL
QPRQVWLWRGALAGVFAAMLVAILQVMNGAERAEGWTNAIVFADIALMLLVVAIFCRPNG
QVRWLLGAAVAAVAVIVLSGSRGVWLSLLVTLGVLVWGAPWQSARMRLLAFVGGAVVCVG
LVLSVPGLTEQLRIGELQSDFQRYEVGDADSSAGARIERLHVAWDTLQAHPLTGVGVGRF
DDAMRELPLCAGDTWLLRCHLGHAHNDLAEWGATQGIPGLLLLIAVYGVPLWMFVRLHRR
SGQRQFRGPAAAGVMIVISYALCGLTQSMFAHQVSASFYAAMVGILAGLAARQAQQHATA
ASPLAQSAR