Protein Info for Xcc-8004.4736.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Possibly related to ydbT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 transmembrane" amino acids 18 to 41 (24 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 179 to 201 (23 residues), see Phobius details amino acids 231 to 258 (28 residues), see Phobius details amino acids 372 to 399 (28 residues), see Phobius details PF03703: bPH_2" amino acids 70 to 149 (80 residues), 71.9 bits, see alignment E=2.1e-24 amino acids 261 to 334 (74 residues), 26.9 bits, see alignment E=2.3e-10 amino acids 409 to 488 (80 residues), 52.9 bits, see alignment E=1.8e-18

Best Hits

KEGG orthology group: K08981, putative membrane protein (inferred from 100% identity to xca:xccb100_3923)

Predicted SEED Role

"Possibly related to ydbT" in subsystem Experimental tye

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XBQ2 at UniProt or InterPro

Protein Sequence (500 amino acids)

>Xcc-8004.4736.1 Possibly related to ydbT (Xanthomonas campestris pv. campestris strain 8004)
VSAIDASTDDEQRLHPLSWLFVLLQQIRQFLIPLAALILFGSRDGSRDSADHLATGIVIA
VLVAISVLRYFTYRYRIGSDGVAIRSGLLERSRRDIPFARIHNVVVHQSLLHRLAGVAEV
RLESAGGHKPEAEMRVLRLDQALALEDLIRRRAHTAEPATAHQAPDVGTLLRLPTSEVIR
LGLISNRGMVVVAAGFGVLYQMIPRRTVSNFVEHNGELAYRYVAQIHPGTAVTATLVVLG
MLVVLVAMRALSVALAVAQYHGFHLSESERRLTVERGLLTRIRSSVALRRIQSWTLYESR
LHALFGRRQLRVDTAVTTGDNDGAALKELAPIAEPQRCDALLQQLLPDVAWPPAAWQPVA
THCWWRLSLPTVLLVLPLTAVLAWRFGAQASWLLLWLPWSAFKAYRQVQRMGYALDARYV
AVRGGWWKRWWRLAELDKLQALQLQRSPLDRLSGTATLLLDTAGASATGPALRLRFVPLA
HAQALQTQLGAALARRKLRW