Protein Info for Xcc-8004.4574.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: ATP synthase delta chain (EC 3.6.3.14)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00213: OSCP
  • amino acids 7 to 173 (167 residues), 154.9 bits, E=1.2e-49
• TIGR01145: ATP synthase F1, delta subunit
  • amino acids 8 to 173 (166 residues), 116.8 bits, E=6.4e-38

Best Hits

Swiss-Prot: 100% identical to ATPD_XANCB: ATP synthase subunit delta (atpH) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K02113, F-type H+-transporting ATPase subunit delta [EC: 3.6.3.14] (inferred from 100% identity to xcc:XCC0551)

MetaCyc: 37% identical to ATP synthase F1 complex subunit delta (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP synthase delta chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

See Q4UQF1 at UniProt or InterPro

Protein Sequence (175 amino acids)

>Xcc-8004.4574.1 ATP synthase delta chain (EC 3.6.3.14) (Xanthomonas campestris pv. campestris strain 8004)
MSQALTLARPYARAAFAIAREGGKFAPWSDALAFSAQVAGDPRVAALLLNPALHQDQAVT
LLAPPAAEADYQRFLGLLADAQRLALLPEIAGLYEQLRAEAEHVVKATVTSATDMSPAEL
ATITAALKKRFGREVDVTTAVDASLIGGAVIDTGEMVIDGSLKGKLARLQNSLAH