Protein Info for Xcc-8004.4523.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Type II secretion system protein-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 TIGR01420: twitching motility protein" amino acids 6 to 341 (336 residues), 441 bits, see alignment E=1.6e-136 PF00437: T2SSE" amino acids 73 to 270 (198 residues), 134.5 bits, see alignment E=2e-43

Best Hits

Swiss-Prot: 43% identical to PILT_PSEAE: Twitching mobility protein (pilT) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02670, twitching motility protein PilU (inferred from 100% identity to xca:xccb100_3757)

Predicted SEED Role

"Type II secretion system protein-like protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XAZ3 at UniProt or InterPro

Protein Sequence (377 amino acids)

>Xcc-8004.4523.1 Type II secretion system protein-like protein (Xanthomonas campestris pv. campestris strain 8004)
MDIGYFLKLMTEKNASDMFLTTGAPVYIKIEGKLYPLGNTGLPPGMVKKIAYSLMDEGQV
PQFERELELNMAIALSDAGRFRVNVFKQRGEVGMVIRAIRSRIPSIEELNLPQVLKDVIM
TPRGLVLVVGSTGSGKSTSLASMIDHRNSTTTGHILTIEDPIEYLHKHKMSIVNQREVGL
DTHAFQSALKNAMREAPDVILIGEILDAETMEAAIAFAETGHLCLATLHSNNADQTIERI
LNFFPESAHKNVLMNLALNLRAVVSQRLVKGLDGRRRPATEVLLNTPMIRDLLRRGQVHE
VKQAMEESLEEGMQTFDQCLFRMVKTGEIEQEEALRAADSRDGLALKFRLSEGGSGEHDP
YADYESASAPKISHGFI