Protein Info for Xcc-8004.4513.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: O-antigen export system permease protein RfbD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 135 to 164 (30 residues), see Phobius details amino acids 174 to 198 (25 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details PF01061: ABC2_membrane" amino acids 48 to 250 (203 residues), 89.2 bits, see alignment E=1.5e-29

Best Hits

KEGG orthology group: K09690, lipopolysaccharide transport system permease protein (inferred from 99% identity to xcc:XCC0600)

MetaCyc: 38% identical to O:8-antigen ABC transporter permease subunit (Escherichia coli O8)
TRANS-RXN-445 [EC: 7.5.2.14]

Predicted SEED Role

"O-antigen export system permease protein RfbD"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XB75 at UniProt or InterPro

Protein Sequence (290 amino acids)

>Xcc-8004.4513.1 O-antigen export system permease protein RfbD (Xanthomonas campestris pv. campestris strain 8004)
LRRGCHTVFLMLTPAAYQVVTISEVATLDMIRSVWAFRYFILSSIRNDLRLRFLRSKLGA
LWMIIHPLMQVLIFATILSEVLAAKLPGVNNKFAYALYLMAGTLCWSMFAESIGKCASLF
VDNGNLMKKQAFPRICLPLIAGGTVMVNNLLLFLAIIVVFAILGHSLGPQAGWLPLLMLL
TLAFAMSIGLLLGIFNVFVRDIGQVVPVVLQAMFWVTPIVYTIDILPQQTRDLFKLNPLF
PLVSAYQGVLLYGRAPDWMSLLPLTAATAILGFVSLVVFRRASAEMVDAL