Protein Info for Xcc-8004.4501.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: UDP-glucose 4-epimerase (EC 5.1.3.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 11 to 158 (148 residues), 48.6 bits, E=2.2e-16
• PF01370: Epimerase
  • amino acids 12 to 239 (228 residues), 152.7 bits, E=4e-48
• PF16363: GDP_Man_Dehyd
  • amino acids 13 to 302 (290 residues), 148.4 bits, E=1.3e-46
• PF01073: 3Beta_HSD
  • amino acids 13 to 152 (140 residues), 37.5 bits, E=5e-13
• PF13460: NAD_binding_10
  • amino acids 16 to 177 (162 residues), 30.9 bits, E=8.9e-11
• PF07993: NAD_binding_4
  • amino acids 71 to 175 (105 residues), 34.3 bits, E=5.1e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to xcb:XC_3626)

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (9/11 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (5/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (2/2 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• D-galactose detoxification (1/3 steps found)
• stachyose degradation (2/7 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (2/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Sequence Analysis Tools

See A0A0H2XB93 at UniProt or InterPro

Protein Sequence (312 amino acids)

>Xcc-8004.4501.1 UDP-glucose 4-epimerase (EC 5.1.3.2) (Xanthomonas campestris pv. campestris strain 8004)
VASHSELKGKRVLVSGASGFTGRYMSQQLKEQGCTVIGVGTRCDGAGTSATDEFWPMDLR
DAADVARVVAQAQADYVVHLAAVAFVGHGDADDFYRVNLLGTRNLLQALAASQHRPERVL
IASSANVYGNATEGVIDESVTPSPANDYAVSKLAMEYVASLWHERLPLVIARPFNYTGVG
QATNFLIPKIVSHFASRASSIELGNTEVWRDFGDVRSVVLAYRKLLQAPAAEGQIVNVCS
GVASSLSDIIRICSKITGHDIDVQVNPAFVRQNEVRKLLGSNARLQELIGDWQSLALEDT
LRWMLEAASTEQ