Protein Info for Xcc-8004.4493.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: sugar translocase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 50 to 68 (19 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details PF04138: GtrA" amino acids 25 to 134 (110 residues), 74.6 bits, see alignment E=3.9e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to xcc:XCC0614)

Predicted SEED Role

"sugar translocase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XB88 at UniProt or InterPro

Protein Sequence (149 amino acids)

>Xcc-8004.4493.1 sugar translocase (Xanthomonas campestris pv. campestris strain 8004)
MRPGDSSQAREFVDRHRPLLAVALRFLLGGALNTGTTLLLYWSLLYFIKYQWAYLISYCA
GILLSYFLNTRYVFRTQHTWLRFAIFPLIYVVVYALGALTLKFCVDHLRVPATLGPLLSI
AVTLPVSFVLTRILLRSDSSAHSQSKTSA