Protein Info for Xcc-8004.4445.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: FIG000988: Predicted permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 57 to 81 (25 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 271 to 288 (18 residues), see Phobius details amino acids 300 to 322 (23 residues), see Phobius details amino acids 328 to 348 (21 residues), see Phobius details TIGR04407: LPS export ABC transporter permease LptF" amino acids 4 to 349 (346 residues), 368.4 bits, see alignment E=1.4e-114 PF03739: LptF_LptG" amino acids 6 to 348 (343 residues), 264.5 bits, see alignment E=6.7e-83

Best Hits

KEGG orthology group: K07091, lipopolysaccharide export system permease protein (inferred from 100% identity to xca:xccb100_3704)

Predicted SEED Role

"FIG000988: Predicted permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XB12 at UniProt or InterPro

Protein Sequence (360 amino acids)

>Xcc-8004.4445.1 FIG000988: Predicted permease (Xanthomonas campestris pv. campestris strain 8004)
MPKLDRYLLSDFTQSFLATLIVLLVVSVGGVLVDILGNIADGRIPARLLLSQVGLQFVAY
LPIILPLALMLGLLLALARLYRDSEMAVITAIGIGPRRMLRPILWLVVPVVVVIGACSLW
LGPWASRTAELMLEDANRSVVMAGLESGKFTPLSGGGVVYLTTISPDGKGLGKVFMQRQK
DDRIDVVTAERGAMFFEGKTDRYLRLEDGHRIEGPAGAQGLDYRLMTFASNDVALPDRTK
AHDANDPEVMSTFKLIGDARPIARAELHRRLAPPLLALAFALLTLPLSRSAPRQQRYGRI
MLAFLAYLVGTNLMIVGTQWIANGKVPGALGLWWLTLPLLAVSIWAYARDGRLSRPRARA