Protein Info for Xcc-8004.4441.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Tyrosine recombinase XerD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 PF02899: Phage_int_SAM_1" amino acids 27 to 107 (81 residues), 52.5 bits, see alignment E=5e-18 TIGR02225: tyrosine recombinase XerD" amino acids 28 to 322 (295 residues), 367.3 bits, see alignment E=2.8e-114 PF00589: Phage_integrase" amino acids 131 to 310 (180 residues), 162.6 bits, see alignment E=7.7e-52

Best Hits

Swiss-Prot: 100% identical to XERD_XANCP: Tyrosine recombinase XerD (xerD) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K04763, integrase/recombinase XerD (inferred from 100% identity to xca:xccb100_3700)

Predicted SEED Role

"Tyrosine recombinase XerD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XCM6 at UniProt or InterPro

Protein Sequence (323 amino acids)

>Xcc-8004.4441.1 Tyrosine recombinase XerD (Xanthomonas campestris pv. campestris strain 8004)
MSASSPAERRQRAQQLPPLRAEDDQAIQRFLDRLWAEQGVARQTLDSYRRDLEGLARWRD
GAGGGLQGADRSALFDYLRWRTEARYAPRSNARLLSTLRGFYALCLRDGVRSDDPTALLD
PPRLPRSLPKALTESQIDALLAAPEIGTPLGLRDRAMLELMYAAGLRVSELVTLPAVAIN
LRQGVLRVTGKGSKERLVPLGEESQHWLERYLETARPTLSERKAVPAVDGQVPLFIDAAR
RPLSRQQFWGLVKRYAAVAGIDPDTVSPHGLRHSFATHLLNHGADLRALQMLLGHSSLST
TQIYTLVARQHLQTLHARHHPRG