Protein Info for Xcc-8004.4398.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Serine hydroxymethyltransferase (EC 2.1.2.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00464: SHMT
  • amino acids 8 to 386 (379 residues), 590.1 bits, E=1.8e-181
• PF00155: Aminotran_1_2
  • amino acids 88 to 350 (263 residues), 36.4 bits, E=3.5e-13

Best Hits

Swiss-Prot: 100% identical to GLYA_XANCB: Serine hydroxymethyltransferase (glyA) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K00600, glycine hydroxymethyltransferase [EC: 2.1.2.1] (inferred from 100% identity to xca:xccb100_3667)

MetaCyc: 70% identical to serine hydroxymethyltransferase (Escherichia coli K-12 substr. MG1655)
4.1.2.-; Glycine hydroxymethyltransferase. [EC: 2.1.2.1]; RXN-6321 [EC: 2.1.2.1]; RXN0-5240 [EC: 2.1.2.1]

Predicted SEED Role

"Serine hydroxymethyltransferase (EC 2.1.2.1)" in subsystem Folate Biosynthesis or Glycine Biosynthesis or Glycine and Serine Utilization or LMPTP YwlE cluster or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle or Serine Biosynthesis (EC 2.1.2.1)

MetaCyc Pathways

• folate transformations III (E. coli) (9/9 steps found)
• folate transformations II (plants) (10/11 steps found)
• superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• glycine degradation (3/3 steps found)
• folate polyglutamylation (4/5 steps found)
• glycine biosynthesis I (1/1 steps found)
• folate transformations I (9/13 steps found)
• glycine betaine degradation III (4/7 steps found)
• formaldehyde assimilation I (serine pathway) (8/13 steps found)
• glycine betaine degradation I (4/8 steps found)
• glycine betaine degradation II (mammalian) (1/4 steps found)
• photorespiration II (5/10 steps found)
• photorespiration I (4/9 steps found)
• photorespiration III (4/9 steps found)
• purine nucleobases degradation II (anaerobic) (14/24 steps found)

KEGG Metabolic Maps

• Cyanoamino acid metabolism
• Glycine, serine and threonine metabolism
• Methane metabolism
• One carbon pool by folate

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.1

Sequence Analysis Tools

See Q4UQT6 at UniProt or InterPro

Protein Sequence (417 amino acids)

>Xcc-8004.4398.1 Serine hydroxymethyltransferase (EC 2.1.2.1) (Xanthomonas campestris pv. campestris strain 8004)
MFSRDVRLETYDPELAKAIAAEAGRQEDHVELIASENYCSPLVMEAQGSQLTNKYAEGYP
GKRYYGGCEFVDIAEQLAIDRIKQVFGADYANVQPHSGSQANQAVYLALLQPGDTILGMS
LAHGGHLTHGAKVNASGKLFNAVQYGVNEQGLIDYDEVQRLATEHKPKMVIAGFSAYSQK
IDWARFRAIADSVGAYLFVDMAHVAGLVAAGVYPSPMDHAHVVTSTTHKTLRGPRGGIIL
AKGAGEDLVKKLQSIVFPGIQGGPLMHVIAAKAVAFKEALEPEFKTYQQQVVKNAQAMAN
TLIARGYKIVSGGTENHLMLVDMIGRDVSGKDAEAALGKAHITVNKNSVPNDPRSPFVTS
GLRLGTPAITTRGYQEQDCVDLANWIADVLDAPADDAVLAKVRDAVTAQCKKYPVYG