Protein Info for Xcc-8004.4297.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Outer membrane hemin receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 743 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR01785: TonB-dependent heme/hemoglobin receptor family protein" amino acids 41 to 743 (703 residues), 346.6 bits, see alignment E=3e-107 TIGR01786: TonB-dependent hemoglobin/transferrin/lactoferrin receptor family protein" amino acids 41 to 743 (703 residues), 408.6 bits, see alignment E=5.3e-126 PF07715: Plug" amino acids 55 to 165 (111 residues), 102.2 bits, see alignment E=3.4e-33 PF00593: TonB_dep_Rec_b-barrel" amino acids 287 to 703 (417 residues), 201 bits, see alignment E=9.9e-63 PF14905: OMP_b-brl_3" amino acids 326 to 627 (302 residues), 27.5 bits, see alignment E=2.5e-10

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to xcc:XCC0768)

Predicted SEED Role

"Outer membrane hemin receptor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XC98 at UniProt or InterPro

Protein Sequence (743 amino acids)

>Xcc-8004.4297.1 Outer membrane hemin receptor (Xanthomonas campestris pv. campestris strain 8004)
MIRLHPLVVALSLALPVVPLCAIAAEADAGAAAARDVHDFDRLQVTATRTQRALVEVPGT
VDVIDREQLDNQLVRELKDLFRYTPGVSVTSTSGRFTGASGVRIRGLDGNRVAILVDNVP
VSDTFNFGSYLNANRNFVDLETLKRVEVVRGPASSLYGSDALGGVVAFVTKDPSDYLSAD
KHSYVGLKFGYEGDWNGLFAGATGAFGGERWSGMVAVSHRQGQEAQNQGDNRSRNYTRTA
PNPQQVDGRSVLGKLVYAPNAQQRFKLTVEGNEDDGRIEALSGIDARSPSASQRILSQDG
RDHQTRARVSLRHELDALDTALADDLFWQLYRQDSASLQRTDELRGNNTRRHNEHHFDQR
VYGLLVNAHKAIDTGTLRHDITYGLEGSWTDTREKRDGYSLNLANGAVSKLVGQDVFPVR
DFPMSETTKLGAYAQDEMRLLDGRLSLIPGVRVDYFRLSPRVDDIFRQDNPGVAAETIDE
QQVSPKFGAVWRFSDAWSAYANYAHGFRAPPYNDVNIGFTNLQARYTAIANPDLKSETSR
GGELGLRFNDTVGYLGVNVYYTDYRNFIESYAPAGVNAEGLLLFQSRNVDDVVIKGAEAR
AGVDLGALAGWQGWSVNSAVAYSQGDNLTDDTPLNSVDPLRGTLGVAFDSERWGAEVIGT
FVARKRRPQLASYYTPAGYATLDLMGHWEFAPGAKVTGGIFNLADRRYVDWNALPNGTLD
SSTVLDRFTGAGRTASVSLAVSW