Protein Info for Xcc-8004.4294.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: membrane protein, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 117 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 36 to 55 (20 residues), see Phobius details amino acids 75 to 92 (18 residues), see Phobius details amino acids 98 to 115 (18 residues), see Phobius details PF04342: DMT_6" amino acids 12 to 115 (104 residues), 155 bits, see alignment E=3.4e-50

Best Hits

KEGG orthology group: K09922, hypothetical protein (inferred from 97% identity to xac:XAC0826)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XCE9 at UniProt or InterPro

Protein Sequence (117 amino acids)

>Xcc-8004.4294.1 membrane protein, putative (Xanthomonas campestris pv. campestris strain 8004)
MPTAPFTAYLYPILLLLASNVFMTFAWYGHLKYKSTPLMIAILVSWGIAFFEYCLQVPGN
RLGSAVYSAPQLKGMQEVITLLVFAGFSTFYLGQSLKWNHWAAFGLILVAAFLMFKE