Protein Info for Xcc-8004.4278.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 19 to 37 (19 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 195 to 213 (19 residues), see Phobius details amino acids 220 to 237 (18 residues), see Phobius details amino acids 252 to 275 (24 residues), see Phobius details TIGR00544: prolipoprotein diacylglyceryl transferase" amino acids 6 to 276 (271 residues), 249.3 bits, see alignment E=2.4e-78 PF01790: LGT" amino acids 9 to 274 (266 residues), 254.8 bits, see alignment E=3.5e-80

Best Hits

Swiss-Prot: 100% identical to LGT_XANCP: Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (lgt) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K13292, phosphatidylglycerol:prolipoprotein diacylglycerol transferase [EC: 2.-.-.-] (inferred from 100% identity to xcb:XC_3445)

Predicted SEED Role

"Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)" (EC 2.4.99.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4UR34 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Xcc-8004.4278.1 Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-) (Xanthomonas campestris pv. campestris strain 8004)
MIYLHAIDPIAFSLGPVQVHWYGLMYLAAFFSAWALGRSRILRGRLPGVDMDGFSDLLFY
GMLGVVLGGRIGYMLFYAFDTFLANPLILFKVWEGGMSFHGGLLGVLIACGLWTRRHRLH
FFDVMDFVAPLVPLGLGFGRLGNFVGGELWGKFTQAGWGVIFPHAPELADWPPAQLQAQY
AAGALDRFARHPSQLYEAALEGVVMFVVLWTFSMKPRARYAVSGLFALLYGVFRFIVEFV
RVPDAPLGYLAFNWLTMGQILSLPLIGVGLVLLALSRRAPVLQPVVPAAAGVEAAK