Protein Info for Xcc-8004.4270.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: 4-hydroxythreonine-4-phosphate dehydrogenase (EC 1.1.1.262)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 TIGR00557: 4-hydroxythreonine-4-phosphate dehydrogenase PdxA" amino acids 5 to 318 (314 residues), 383 bits, see alignment E=6.5e-119 PF04166: PdxA" amino acids 32 to 314 (283 residues), 336.8 bits, see alignment E=5.7e-105

Best Hits

Swiss-Prot: 100% identical to PDXA_XANCP: 4-hydroxythreonine-4-phosphate dehydrogenase (pdxA) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K00097, 4-hydroxythreonine-4-phosphate dehydrogenase [EC: 1.1.1.262] (inferred from 100% identity to xcc:XCC0792)

MetaCyc: 50% identical to 4-hydroxythreonine-4-phosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
4-hydroxythreonine-4-phosphate dehydrogenase. [EC: 1.1.1.262]

Predicted SEED Role

"4-hydroxythreonine-4-phosphate dehydrogenase (EC 1.1.1.262)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.1.1.262)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.262

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4UR40 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Xcc-8004.4270.1 4-hydroxythreonine-4-phosphate dehydrogenase (EC 1.1.1.262) (Xanthomonas campestris pv. campestris strain 8004)
MVPSLALVPGEPAGIGPELCIRLAQQPRSDAHLIAYADPDTLHSAAKALCLSVRLLDPDQ
HARLPGDLPLHPVRQAAPTRFGTPDPANAAAVIAGLLGAAGDCLSGKLQGIVTGPVHKAV
INAGGIAYTGTTELLAAQAGCPVVMMLANSIVRVALVTTHLPLRAVPEAITAEALARCLR
ITATAMQRDFGLEHPRIAVLGLNPHAGEDGLLGREELDVIIPVLDQLRSEGMQLIGPLPA
DTAFLPQKLTDFDAVVAMYHDQGLPVLKYSGFEQAVNITLGLPYPRVAVDHGTALELAGR
GVADPSSLLAATALCARLAARS