Protein Info for Xcc-8004.4262.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: 2-octaprenyl-6-methoxyphenol hydroxylase (EC 1.14.13.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01988: ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family
  • amino acids 35 to 418 (384 residues), 366.3 bits, E=1.7e-113
• TIGR01984: 2-polyprenyl-6-methoxyphenol 4-hydroxylase
  • amino acids 35 to 418 (384 residues), 452.1 bits, E=1.4e-139
• PF01494: FAD_binding_3
  • amino acids 35 to 367 (333 residues), 112.3 bits, E=3.2e-36

Best Hits

KEGG orthology group: K03185, 2-octaprenyl-6-methoxyphenol hydroxylase [EC: 1.14.13.-] (inferred from 98% identity to xca:xccb100_3553)

MetaCyc: 100% identical to 4-hydroxy-3-polyprenylbenzoate 5-hydroxylase (Xanthomonas campestris pv. campestris)
1.14.13.M81 [EC: 1.14.13.M81]

Predicted SEED Role

"2-octaprenyl-6-methoxyphenol hydroxylase (EC 1.14.13.-)" in subsystem Ubiquinone Biosynthesis (EC 1.14.13.-)

MetaCyc Pathways

• ubiquinol-8 biosynthesis (late decarboxylation) (8/9 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (2/9 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Bisphenol A degradation
• Brassinosteroid biosynthesis
• Carotenoid biosynthesis - General
• Cyanoamino acid metabolism
• Flavonoid biosynthesis
• Histidine metabolism
• Isoflavonoid biosynthesis
• Limonene and pinene degradation
• Methane metabolism
• Naphthalene and anthracene degradation
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Styrene degradation
• Toluene and xylene degradation
• Tryptophan metabolism
• Ubiquinone and menaquinone biosynthesis
• gamma-Hexachlorocyclohexane degradation

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.- or 1.14.13.M81

Sequence Analysis Tools

See A0A0H2XCC9 at UniProt or InterPro

Protein Sequence (431 amino acids)

>Xcc-8004.4262.1 2-octaprenyl-6-methoxyphenol hydroxylase (EC 1.14.13.-) (Xanthomonas campestris pv. campestris strain 8004)
MGEGIRSRRGNVSHSGGGNGPGSKAYHVPMTHVHDVLIVGGGLVGSSLAIALDRIGLDVG
LVEATPAGAPPAVFDQRNLSFAAATVNALGTLGVMAKLRTAPGPIRRIHVSRAGDFGRVQ
LDAADYGRDSFGQVVVARDFGEALQARLDELRSLQRYRPARCIGVEPVQDGSRAVRLATA
DGEQLVRARLVVGADGSHSAVRELLHIGTEQHDFLQTLFVARVRASRPPDGTAWERFGEH
GPTALLPRGDRHYGAIHCVARAEAETVAALDEAGWLARLQRAAGWRAGRFVASGERSAYP
LVQILANTVVAERVVLLGNAAQTLHPIGAQGFNLGLRDALTLAELIEPDRSDAGAAPLLA
EYLARRRVDRDHTIGFSSGLARLTGNPAPLLRPLRSLGLLAASQAAPLQSMLVGGAMGFR
GDVPQLCRSQA