Protein Info for Xcc-8004.4168.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: GTP-binding and nucleic acid-binding protein YchF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00092: GTP-binding protein YchF
  • amino acids 23 to 385 (363 residues), 514.9 bits, E=6.4e-159
• PF02421: FeoB_N
  • amino acids 26 to 66 (41 residues), 31.5 bits, 1.8e-11
• PF01926: MMR_HSR1
  • amino acids 27 to 137 (111 residues), 73.7 bits, E=2e-24
• PF06071: YchF-GTPase_C
  • amino acids 301 to 384 (84 residues), 125.8 bits, E=8.8e-41

Best Hits

Swiss-Prot: 70% identical to YCHF_HAEIN: Ribosome-binding ATPase YchF (ychF) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K06942, (no description) (inferred from 100% identity to xca:xccb100_3474)

MetaCyc: 68% identical to redox-responsive ATPase YchF (Escherichia coli K-12 substr. MG1655)
Nucleoside-triphosphatase. [EC: 3.6.1.15, 3.6.1.5]

Predicted SEED Role

"GTP-binding and nucleic acid-binding protein YchF" in subsystem Universal GTPases

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (7/8 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• UTP and CTP dephosphorylation II (1/3 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism
• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.15

Use Curated BLAST to search for 3.6.1.15 or 3.6.1.5

Sequence Analysis Tools

See A0A0H2XAG9 at UniProt or InterPro

Protein Sequence (385 amino acids)

>Xcc-8004.4168.1 GTP-binding and nucleic acid-binding protein YchF (Xanthomonas campestris pv. campestris strain 8004)
MGNGRSAALPFPIPDSPFTGQPMGIKCGIVGLPNVGKSTLFNALTKAGIAAANFPFCTIE
PNVGVVPVPDPRLNELAEIVKPQKLIPTAVEFVDIAGLVAGAASGEGLGNKFLAHIREVD
AITHVVRCFEHADIIHVNNKVDPIADIETIDTELALADLDSVEKALNRAERSAKGGDKEA
AARKPVLAKLQAALADGKAGRSAGLDEEEKALVRDLFLLTLKPVMYICNVLEDGFENNPH
LDAVRAHAATEGAEVVPVSAAIEEELSQLDDADRDTFLADLGLDEPGLNRVIRAAYKLLG
LQTYFTAGVREVRAWTVKAGSTAPQAAAVIHTDFEKGFIRAETIAFDDFIKYRGESGARD
AGRLRLEGKEYRVKEGDVLHFRFNV