Protein Info for Xcc-8004.4162.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Translation elongation factor Tu

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 TIGR00485: translation elongation factor Tu" amino acids 1 to 396 (396 residues), 741.1 bits, see alignment E=2.3e-227 PF00009: GTP_EFTU" amino acids 11 to 203 (193 residues), 205.5 bits, see alignment E=8.6e-65 TIGR00231: small GTP-binding protein domain" amino acids 13 to 149 (137 residues), 49.6 bits, see alignment E=3.7e-17 PF03144: GTP_EFTU_D2" amino acids 227 to 296 (70 residues), 79.6 bits, see alignment E=2.9e-26 PF03143: GTP_EFTU_D3" amino acids 300 to 394 (95 residues), 137.7 bits, see alignment E=2.5e-44

Best Hits

Swiss-Prot: 100% identical to EFTU1_XANCP: Elongation factor Tu-A (tufA) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K02358, elongation factor Tu (inferred from 99% identity to xca:xccb100_3461)

Predicted SEED Role

"Translation elongation factor Tu" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4URC5 at UniProt or InterPro

Protein Sequence (396 amino acids)

>Xcc-8004.4162.1 Translation elongation factor Tu (Xanthomonas campestris pv. campestris strain 8004)
MARAKFLREKLHVNVGTIGHVDHGKTTLTAALTKIGAERFGGEFKAYDAIDAAPEEKARG
ITISTAHVEYESAVRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPHIVVFLNKADMVDDAELLELVEMEVRELLSKYDFPGDDTPIIHGSARLALE
GDQSDIGVPAILKLVEALDTFIPDPTRDVDRPFLMPVEDVFSISGRGTVVTGRIERGIIK
VGDEIEIVGIRDTQKTTVTGVEMFRKLLDQGQAGDNAGLLLRGTKRDDVERGQVLCKPGS
IKPHTEFEAEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDITGACQLPEGVEMVMPGDNVK
MVVTLINPVAMDEGLRFAIREGGRTVGAGVVAKIIK