Protein Info for Xcc-8004.4086.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Sulfate transport system permease protein CysT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 68 to 92 (25 residues), see Phobius details amino acids 104 to 126 (23 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 248 to 272 (25 residues), see Phobius details TIGR00969: sulfate ABC transporter, permease protein" amino acids 12 to 275 (264 residues), 324.9 bits, see alignment E=4.2e-101 TIGR02139: sulfate ABC transporter, permease protein CysT" amino acids 15 to 278 (264 residues), 423.7 bits, see alignment E=3.1e-131 PF00528: BPD_transp_1" amino acids 82 to 276 (195 residues), 79.1 bits, see alignment E=1.8e-26

Best Hits

Swiss-Prot: 52% identical to CYST_ECOLI: Sulfate transport system permease protein CysT (cysU) from Escherichia coli (strain K12)

KEGG orthology group: K02046, sulfate transport system permease protein (inferred from 100% identity to xcb:XC_3294)

MetaCyc: 52% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysU (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysT" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XAH8 at UniProt or InterPro

Protein Sequence (284 amino acids)

>Xcc-8004.4086.1 Sulfate transport system permease protein CysT (Xanthomonas campestris pv. campestris strain 8004)
MSVAPPPARASRRRVMPGLGLSLGITLTWLGLIVLIPLLGVFIKTSGLGWDGLWRVWSEP
RVLSALRVSFGTAFAAGAFNAVMGTWVAWVFVRYRFPGKRLFDALIDLPFALPTAVAGIA
LTALYGGNGWVGRWLEAIGIKVAYTQLGIVIALVFVGLPFVVRVVQPVLAESEREIEEAA
ATLGASRWQLVWRVVLPALWPAVLTGFALAFARGVGEYGSVIFIAGNLPNATEIAPLLIT
IRLEEFDYAGATAIAAAMLLLSFVILLVVNTLQARLLRYQRSSA