Protein Info for Xcc-8004.4085.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Sulfate transport system permease protein CysW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 37 to 60 (24 residues), see Phobius details amino acids 82 to 107 (26 residues), see Phobius details amino acids 119 to 142 (24 residues), see Phobius details amino acids 170 to 193 (24 residues), see Phobius details amino acids 233 to 257 (25 residues), see Phobius details amino acids 277 to 299 (23 residues), see Phobius details TIGR00969: sulfate ABC transporter, permease protein" amino acids 33 to 306 (274 residues), 283.1 bits, see alignment E=2.4e-88 TIGR02140: sulfate ABC transporter, permease protein CysW" amino acids 35 to 308 (274 residues), 396.5 bits, see alignment E=5.7e-123 PF00528: BPD_transp_1" amino acids 98 to 304 (207 residues), 39.8 bits, see alignment E=2.1e-14

Best Hits

Swiss-Prot: 50% identical to CYSW_SYNY3: Sulfate transport system permease protein CysW (cysW) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02047, sulfate transport system permease protein (inferred from 100% identity to xca:xccb100_3411)

Predicted SEED Role

"Sulfate transport system permease protein CysW" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XA34 at UniProt or InterPro

Protein Sequence (317 amino acids)

>Xcc-8004.4085.1 Sulfate transport system permease protein CysW (Xanthomonas campestris pv. campestris strain 8004)
MTDAVSPLPTMLQSTATARQARRITESATSEPRWVQWLMILGALGFLLAFLLLPLVLVFA
EALRGGWATFLHALVDPDALSAIKLTLLVTAVVLPLNLVFGVAAAWAVSKHQFPGKRLLI
SLIDLPFSVSPVVAGLIFVLIFGRNGWAWPLIYEGWRVELPALGVVLIQLPRIVFALPGI
VLATTFVTFPFIARELMPLMEQQGSDEELAALSLGANGWQMFWRVTVPNIRWGLLYGVLL
CAARAMGEFGAVSVVSGHIRGRTNTLPLHVEILYNEYAYSAAFACASLLALTALLTLAVK
TYLEWRHGDALAANHRH