Protein Info for Xcc-8004.4063.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Phosphate regulon sensor protein PhoR (SphS) (EC 2.7.13.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 signal peptide" amino acids 7 to 11 (5 residues), see Phobius details transmembrane" amino acids 12 to 27 (16 residues), see Phobius details amino acids 33 to 50 (18 residues), see Phobius details PF11808: PhoR" amino acids 8 to 93 (86 residues), 76.2 bits, see alignment E=4.2e-25 TIGR02966: phosphate regulon sensor kinase PhoR" amino acids 97 to 424 (328 residues), 414.6 bits, see alignment E=1.3e-128 PF13188: PAS_8" amino acids 101 to 155 (55 residues), 29.1 bits, see alignment 1.4e-10 PF00512: HisKA" amino acids 210 to 272 (63 residues), 69.5 bits, see alignment E=4.2e-23 PF02518: HATPase_c" amino acids 318 to 424 (107 residues), 94.1 bits, see alignment E=1.5e-30

Best Hits

KEGG orthology group: K07636, two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC: 2.7.13.3] (inferred from 100% identity to xca:xccb100_3389)

Predicted SEED Role

"Phosphate regulon sensor protein PhoR (SphS) (EC 2.7.13.3)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XBY2 at UniProt or InterPro

Protein Sequence (442 amino acids)

>Xcc-8004.4063.1 Phosphate regulon sensor protein PhoR (SphS) (EC 2.7.13.3) (Xanthomonas campestris pv. campestris strain 8004)
MPQHIRSAWLKTLGTLALLLGAAVLAGVLIGHVWMALTLTALSVLAWHYWRLRQVLRRLT
ARQRAEPAAGVGAWNELDRLLYRSQAEMRARKRRLIDMLRTYRAAAQALPDAVVVVDRNS
QRVQWFNKAAAGLLGLHHPGDMGVSVVERLQPLPLAHWLAAGRNAEPMLDAASPVDPDLR
LNLRLIPYSDDYWLLVARDVSKLLRLEQVRRDFVANVSHELRTPLTVVHGYLDMLDPEDF
PDSGPMLAEMRKQSQRMAQLVEDLLTLSRLESQEELGEEHVAMAPMLSTLRREAEAHSQG
RHTVEVFDEAGVDLLGSNKELHSAFSNLVTNAVRYTPGGGTVTIRFVREGDGAALAVRDT
GYGIPASHLPRITERFYRVSSSRSRESGGTGLGLSIVKHILGLHQARLEIESEVGRGSEF
SCHFGAARVVQREQSLPLSRSA