Protein Info for Xcc-8004.4031.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: protein phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 PF13672: PP2C_2" amino acids 17 to 192 (176 residues), 48.9 bits, see alignment E=9.5e-17 PF00481: PP2C" amino acids 23 to 127 (105 residues), 42.7 bits, see alignment E=8.6e-15 PF07228: SpoIIE" amino acids 31 to 232 (202 residues), 25.4 bits, see alignment E=1.9e-09

Best Hits

KEGG orthology group: K01090, protein phosphatase [EC: 3.1.3.16] (inferred from 100% identity to xcc:XCC0989)

Predicted SEED Role

"protein phosphatase"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XAB4 at UniProt or InterPro

Protein Sequence (234 amino acids)

>Xcc-8004.4031.1 protein phosphatase (Xanthomonas campestris pv. campestris strain 8004)
MLEFGHLTHVGLRRDLNEDTYYGDSELGLWLVADGMGGHACGEVASALARETIVREVRAG
TPLAQAVRIADEEIIKTSRRCNDTLPMGTTVVAARVLGQRFEVAWVGDSRAYLWRDGRLA
QLSQDHSYVQELIAQGTLTSEQARAHPHRNVVTQALGVTDPAHLNVATMQGELKSGMQLL
LCSDGLTEEVDDTAIATTLSQADCSAQECVECLVAAALDGGGSDNITAILVRSH