Protein Info for Xcc-8004.4013.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: FIG000557: hypothetical protein co-occurring with RecR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 TIGR00103: DNA-binding protein, YbaB/EbfC family" amino acids 2 to 102 (101 residues), 107.9 bits, see alignment E=1.3e-35 PF02575: YbaB_DNA_bd" amino acids 9 to 96 (88 residues), 110.2 bits, see alignment E=2.3e-36

Best Hits

Swiss-Prot: 100% identical to Y1002_XANCP: Nucleoid-associated protein XCC1002 (XCC1002) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K09747, hypothetical protein (inferred from 94% identity to xal:XALc_0613)

Predicted SEED Role

"FIG000557: hypothetical protein co-occurring with RecR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4URN6 at UniProt or InterPro

Protein Sequence (106 amino acids)

>Xcc-8004.4013.1 FIG000557: hypothetical protein co-occurring with RecR (Xanthomonas campestris pv. campestris strain 8004)
MRGNIAQLMQQAQKMQENLQRAQEELAKLEVTGSAGGGMVSVTLTGAKECRKVRIDPSIL
SDQEMAEDLIAAAFNDASNKIDAESKERMGSATAGMQLPPGMKLPF