Protein Info for Xcc-8004.4013.1 in Xanthomonas campestris pv. campestris strain 8004
Annotation: FIG000557: hypothetical protein co-occurring with RecR
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to Y1002_XANCP: Nucleoid-associated protein XCC1002 (XCC1002) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
KEGG orthology group: K09747, hypothetical protein (inferred from 94% identity to xal:XALc_0613)Predicted SEED Role
"FIG000557: hypothetical protein co-occurring with RecR"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q4URN6 at UniProt or InterPro
Protein Sequence (106 amino acids)
>Xcc-8004.4013.1 FIG000557: hypothetical protein co-occurring with RecR (Xanthomonas campestris pv. campestris strain 8004) MRGNIAQLMQQAQKMQENLQRAQEELAKLEVTGSAGGGMVSVTLTGAKECRKVRIDPSIL SDQEMAEDLIAAAFNDASNKIDAESKERMGSATAGMQLPPGMKLPF