Protein Info for Xcc-8004.4012.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Recombination protein RecR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 TIGR00615: recombination protein RecR" amino acids 3 to 193 (191 residues), 240.9 bits, see alignment E=4e-76 PF21176: RecR_HhH" amino acids 5 to 49 (45 residues), 80.2 bits, see alignment 1.9e-26 PF02132: RecR_ZnF" amino acids 52 to 72 (21 residues), 28.9 bits, see alignment (E = 1.9e-10) PF01751: Toprim" amino acids 79 to 159 (81 residues), 43.8 bits, see alignment E=5.9e-15 PF13662: Toprim_4" amino acids 79 to 169 (91 residues), 84.6 bits, see alignment E=1.2e-27 PF21175: RecR_C" amino acids 171 to 193 (23 residues), 46.8 bits, see alignment (E = 4.4e-16)

Best Hits

Swiss-Prot: 100% identical to RECR_XANC8: Recombination protein RecR (recR) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K06187, recombination protein RecR (inferred from 100% identity to xca:xccb100_3357)

MetaCyc: 59% identical to recombination mediator protein RecR (Escherichia coli K-12 substr. MG1655)
RXN0-2606

Predicted SEED Role

"Recombination protein RecR" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4URN7 at UniProt or InterPro

Protein Sequence (197 amino acids)

>Xcc-8004.4012.1 Recombination protein RecR (Xanthomonas campestris pv. campestris strain 8004)
MSSLLEQLIEAFRVLPGVGQKSAQRMAYHVLEREREGGRRLAAALANAVEKVGHCVQCRD
FTESEVCAICANSGRDRQQLCVVESPADRLAIEHATGYRGVYFILQGRLSPLDGIGPREL
GLDRLAERLAAGEVTEMIIATNATVEGEATAHYLAQLARQHSVRPSRLAQGMPLGGELEY
VDRGTLSHAFGTRSEVL