Protein Info for Xcc-8004.4009.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: FIG001454: Transglutaminase-like enzymes, putative cysteine proteases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 649 transmembrane" amino acids 21 to 48 (28 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 79 to 95 (17 residues), see Phobius details amino acids 105 to 122 (18 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 167 to 184 (18 residues), see Phobius details amino acids 543 to 563 (21 residues), see Phobius details PF11992: TgpA_N" amino acids 15 to 329 (315 residues), 210.9 bits, see alignment E=2.5e-66 PF01841: Transglut_core" amino acids 356 to 470 (115 residues), 99.2 bits, see alignment E=1.7e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to xcc:XCC1006)

Predicted SEED Role

"FIG001454: Transglutaminase-like enzymes, putative cysteine proteases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XAA4 at UniProt or InterPro

Protein Sequence (649 amino acids)

>Xcc-8004.4009.1 FIG001454: Transglutaminase-like enzymes, putative cysteine proteases (Xanthomonas campestris pv. campestris strain 8004)
MTEPTAPITQASRGWVLATTWLALAPLLLQLPGLLAGTIAVAALLVGVMSWRGSLMAPVR
LLLVIAMLAAVYWQIGMRFGRDTGCAVLAAMLAIKASELRTLRDARSLLGFALFAPFAAF
LLDQGPATMGLALLAVLSALLCMQRLADEEHRTGTPGLRLQLRSIGKLVAIGVPLALATF
WLLPRLSSPLWGVPERALSRPGLSDNMSPGEWIDLMADDSPALRVQFTGKAPPPEQRYWR
GPVMWDFDGRTWQRARWTGRAQPAAFAAGPATYRYRLDYEPTDRRQLVALDLPVQGVANA
ELSPDYELFAQRPLSALTRWDLQSAPPARFDTDLPAPLRARALALPPGFNPRTIALARQW
RAEAGRDDAAVVQRALQWITREFAYTLDTPLLGRNSVDEFLFQQKAGFCEHFSSSFVVLM
RAAGIPARVVTGYAGGTYNGLGNYWVVRRMDAHAWSEVWLAGRGWVRVDPTAAVAPERIY
DTLEDRLQAGGGGGGQLGTWDRLGEVSDWLRRGWNELVLSFDADRQQRLLQPFGIDRLDT
NQLAAIFGVFAVSALAWMGWLLARGERERDPLLRAWHRLGRRYRKLGLAREPHEPATTWA
QRVAQHDPHTTLLALSQRFAAARYAGADSDSASLIKDLQQHRPRTGASS