Protein Info for Xcc-8004.3998.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: 3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.41)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 306 to 323 (18 residues), see Phobius details TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III" amino acids 6 to 324 (319 residues), 450.3 bits, see alignment E=1.7e-139 PF00108: Thiolase_N" amino acids 39 to 149 (111 residues), 30.1 bits, see alignment E=4.8e-11 PF08545: ACP_syn_III" amino acids 110 to 187 (78 residues), 121.1 bits, see alignment E=2.1e-39 PF08541: ACP_syn_III_C" amino acids 236 to 325 (90 residues), 129.3 bits, see alignment E=7.4e-42

Best Hits

Swiss-Prot: 100% identical to FABH_XANC8: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 100% identity to xcc:XCC1016)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.41)" in subsystem Fatty Acid Biosynthesis FASII (EC 2.3.1.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180, 2.3.1.41

Use Curated BLAST to search for 2.3.1.180 or 2.3.1.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4URQ0 at UniProt or InterPro

Protein Sequence (325 amino acids)

>Xcc-8004.3998.1 3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.41) (Xanthomonas campestris pv. campestris strain 8004)
MSKRIYSRIAGTGSYLPEKVLTNDDMSKIVDTSDEWIRSRTGIRERHIVADDQTTSDLAY
FASLKAMEAAGVTADEIDLIVVGTTTPDLIFPSTACLLQARLGNVGCGAFDVNAACSGFV
YALSVADKFVRSGDAKTVLVVGAETLTRIVDWTDRTTCVLFGDGAGAVVLKADEDTGILS
THLHADGSKKELLWDPVGVSVGFGEGKNGGGALLMKGNDVFKYAVKALDSVVDETLAANG
LDTHDLDWLIPHQANLRIIEATAKRLDLPMEQVVVTVDRHGNTSSASVLLALDEAVRSGR
VQRGQLLLLEAFGGGFTWGSALLRY